SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DGD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DGD2
Domain Number 1 Region: 239-518
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.35e-85
Family Ankyrin repeat 0.0000267
Further Details:      
 
Domain Number 2 Region: 70-205
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000183
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DGD2
Sequence length 528
Comment (tr|A2DGD2|A2DGD2_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY20528.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_239000 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIKTNLIDSKKLYPQSIIRNILNIIPYNNRYTKSYLSLAKLISDDYHVEEVRRIPIISNY
MFYKEYGIKLDKSNDFEKIQTENLSIHTENTIYKAIMYNDKETFISFTERGGFDKDQILD
SRLYPDSEKGYSLLELCCYHGAVDCFKLLRTKFNSEITETCLQFSFLGGNPEIMSECLKS
QTPNKECMKYATISHNIDFVTFLLNDFNININLEYCAKFNLESFLVYFDQTNDIHRCYTY
SALFEMLSLCEYFLSLRTNINISMGEYGTALHIAAMYNCKEIAEFLISHGANINEKTNKG
STPLHDAAKSNNKEIAEFLISHEKRTALHDAARYNSKEMAELLISLGLNINKKDRHENTP
LHDAAWKNSKETVEFLLSHGANIKEKNNVGKTAFHLAALNNCKETVEYLLSHGPNINEKD
NNGYTALRIALDDSKGEIANLLLSHGANVNEKDKNVKTVLHFAVEYYNKKTIEVLLSHGA
NINEKDRYGKTALQYALDYNKNDIAELLISHGANINTNIKDAPKYMLI
Download sequence
Identical sequences A2DGD2
88273.m00312 gi|121915742|gb|EAY20528.1| gi|154416986|ref|XP_001581514.1| 5722.A2DGD2 XP_001581514.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]