SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DH11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DH11
Domain Number 1 Region: 288-662
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.23e-132
Family Ankyrin repeat 0.00000251
Further Details:      
 
Domain Number 2 Region: 646-997
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.73e-129
Family Ankyrin repeat 0.00000365
Further Details:      
 
Domain Number 3 Region: 129-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000837
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DH11
Sequence length 1002
Comment (tr|A2DH11|A2DH11_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY20321.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_192970 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MKKVNYEELMDLYKDFNYVYDSLYKLKTFSEEGINKIYLDIKNLMLETKHESPNQILTII
ATAMPFNVKYIKPYKEIFKMIYTEYHPIFTRKEIQSTPYILWADLQDENGVLLSTRYSSE
IEANKTKDYSLNFIEENTIYRAIIYDDKFSFIIFTETDSFDMNQMFQSDLYPSSPNSLLE
LCCYHGAVNCFKLLISKFDSIITPKCLYYSFLGGNPDIIHECLLYEIPDEKCMKYAIISH
NIDFVTFLMNEFALEIDLNYCTLYHNFQAFLVYLDQSKYINKFFIYSASFCIPSLCEYFL
SHGAFIDSKTQSGETVLHFAARFNCIETGEILISYGADVNAKDKNGRSVLHEAARNNTKE
IAELLISHGADVSARDKNGWSVLHSAARSNSKEIAEFLISHGADVSARDKNGWSVLHAAA
KANNKETVEFLILHDANVNAKNNDGWSVLHSAAGSNSKEIAEFLILHGADVNSKDKNGWS
VLHSAADSNSKEIAELLISHGADVNSKDNDGWSVLHSAADSNSKEIAELLISHGADVNSK
DNDGWSVLHSAARSNSKEIAEFLISHGADVNSKNNDGWSVLHFAADSNSKEIAEFLISHG
ADVNSKNNDGWSVLHSAARSNSKEIAEFLISHGADVNSKNNDGWSVLHSAAGSNSKEIAE
FLISHGADVNSKDNDGWSVLYIAARNNSKEIAEFLISHGADVNSKNNDGWSVLHSAAGSN
SKEIAEFLILHGADVNSKDNDGWSVLHSAARSNSKEIAEFLILHGADVNSKDKNGWSVLH
SAARSNSKEIAEFLILHGADVNSKDNDGWSVLHFAADSNSKEIAELLISHGADVNSKNND
GWSVLHFAAGSNSKEIAEFLILHGADVNSKDNDGWSVLHSAADSNSKEIAEFLISHGADV
NSKNNDGWSVLHFAADSNSKEIAEFLISHGADVNSKNNDGWSVLHSAADSNSKEIAEFLI
LHGADVNSKDKNGWSVLHSAADSNSKEIAKFLILHGACTVNK
Download sequence
Identical sequences A2DH11
5722.A2DH11 XP_001581307.1.43485 86673.m00379 gi|121915533|gb|EAY20321.1| gi|154416570|ref|XP_001581307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]