SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DJF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DJF1
Domain Number 1 Region: 217-435
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.65e-77
Family Ankyrin repeat 0.0000625
Further Details:      
 
Domain Number 2 Region: 60-183
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000693
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DJF1
Sequence length 436
Comment (tr|A2DJF1|A2DJF1_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY19538.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_136690 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIPYNNRYTKSYLFLAKLISDDYHITEVNRVELISTFLFYKEYGIKLDKSADFEEDYSEN
LEIHTGDTIYRAIMHNDLERFIYFTERDEFDKDQILKSRLYPYSFEGYSLLELCCYHGAV
DCFKLLRSKFKSEITQKCLQFSFLGRNQEIMSECLKYQTPDNECMSYAIISHNIDFVTFL
MNEYNIMIDLESIGYYSNLEAFLVYFDQTNDINKCFVYSPIFNIPSLLEYFLSHGANINE
KNENGKTALHMAAMKNTKETAEFLISHGANINEKDTYGRTALHMAALNNSKETAEVLISH
GINVNEKNKGGETALHNAVLSNSKETAEVLISHGANINEKTKYGETALHFAARNTSKETA
ELLISHGGNINEKDGDGKTALHEAAGFNCKRTAELLISHGANINEKDGEGKTALNIAIDA
NHKEMAEFLISHGAKK
Download sequence
Identical sequences A2DJF1
XP_001580524.1.43485 84843.m00240 gi|121914742|gb|EAY19538.1| gi|154414996|ref|XP_001580524.1| 5722.A2DJF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]