SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DJT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DJT1
Domain Number 1 Region: 407-697
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.44e-96
Family Ankyrin repeat 0.0000203
Further Details:      
 
Domain Number 2 Region: 179-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-85
Family Ankyrin repeat 0.0000181
Further Details:      
 
Domain Number 3 Region: 29-145
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000034
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2DJT1
Sequence length 746
Comment (tr|A2DJT1|A2DJT1_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY19295.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_452090 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MFYKEYGIQLDKSDDFESSYFKDLDIHSENTIYRVIMDNDLERLILFTEREDFDKNKLFD
GDLYPYHYSGNSLLELCCYHAAVDCFKLLRSKFNSEITQKYLQFSFLGGNPEIMSECLKY
QQPDKYCIEYAIISHNIDFVTFLMNEYNIEIDLCQCGSYQNLESFLVYYDQTKDISNCFV
YSVMFGIPALCEYFLSHGANINETNRDRKTALHIAADNNKIKIVEFLLFHGANVNEKGNF
GETALHIAINNNYKEIAELLVLHGANVNEKDNRKRTALQIAAEKNRKEIAELLLLHGANV
NEKDIRKSTALHFAAYKNCIETAELLLTHGADVNEKDDYGITALHIATNNNSIELVELLL
SHGADINKRDNMGKTALQIATGQINQELIKLLLLHGANVNERSQYGTTLQIATDKNNIEL
VKLLLSHGANINEKDQFGTMLHFAAEKNRKEIFELFLSYGGDINEKDCLRATVLHYAAQS
NSKEIAELLLTHGANANEKDIWGKTILQYAADNCSKETAELLLLYGANTNEKDEDGRTAL
HYAAENNGKETAELLLSHGANINEKDEDGRTALHYAAENNGKETAELLLSHGANINEKDE
DGRTALHYAAENNGKETAELLLSHGANINEKDEDGRTALHYAAENNGKETAELLLSNGAA
INEKDEKQKTALHFASKNNSIETAELLLSHGAEINEKIIEEQLLFIVQHIKIVKIQLKFF
LHMAQMSTQKLVTVEQLFILQQIIIV
Download sequence
Identical sequences A2DJT1
5722.A2DJT1 XP_001580281.1.43485 95912.m00278 gi|121914497|gb|EAY19295.1| gi|154414508|ref|XP_001580281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]