SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DJZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DJZ2
Domain Number 1 Region: 287-653
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-102
Family Ankyrin repeat 0.00000705
Further Details:      
 
Domain Number 2 Region: 133-248
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000745
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2DJZ2
Sequence length 657
Comment (tr|A2DJZ2|A2DJZ2_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY19356.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_452710 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MGSPYDDAIDMCRDFHDAYCELYRVKTTDGEEINRIFNHIKYTLIERYKVPPAAIISKIS
NCISIYNNRYLNSYWSLIKKIYDDSKCEIYDISTEFDFFFYKEYGFVFNSETENWIKHFE
RKRLSPNMHDADPMFRAIMNDDLKIFIDLSEKSSFHPNISIRLTLYPSNDGREYSLLELC
SYHGAASCFKFLRSKYNSLITQTCLRFSFLGGNPEIISECLKKIRPKEKCMEYAIISHNI
DFITFLMNEYNLIINLDHCILHNNIQAFLVYLDQTKDINSCLVASPAFNLPPLVEHLISK
CNDINATNIDGKMALHIATECGSMKTIKILISHGADVNAKDMNGRTALHIASRKNYDKIA
KFLVSHNADVNLKDKNGKSALYYAIMSNYKEIAKILIAHGSNFDEKNGEGKNFLHIALEH
YQAEISNFLINHGVDINQKDNNGYSPLHYIAASNSMHSVMELLISKGADINAQDNNGKTS
LHLAASKEHSIIVEYLITNMADLNLKDYSGKTPLHYAAMNEITNSLKLIISHGADLNSKD
NMGKVALHYAVLNNRKNAAELLILHGININETDNIGKTALHYAVVNNNIGLVELIASNKA
DVNLTDNYGKTALHYAAAKQNQEIVKFLILHDADITIRDFYRKTASNYAKKANLFNF
Download sequence
Identical sequences A2DJZ2
XP_001580342.1.43485 gi|121914558|gb|EAY19356.1| gi|154414630|ref|XP_001580342.1| 5722.A2DJZ2 95912.m00214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]