SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DL02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DL02
Domain Number 1 Region: 291-583
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-78
Family Ankyrin repeat 0.000042
Further Details:      
 
Domain Number 2 Region: 60-246
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000034
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2DL02
Sequence length 584
Comment (tr|A2DL02|A2DL02_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY18955.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_146990 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MNKDQYYEVMALCKDYYEIFNTLYRLNTTNQSELTKIYQDINSILIKTKLLEPSERLDII
STASEYNCRYFKSYWTLYKMIYENDPEKVLSNSFLFNYFANKEYELGIDEELNEYDSKDY
ILDVHEENTIFRAIMDDDAKSFETFINSDGFNINQKLKSKFYPYNIQNDNQYSLLELCCF
HGSVNCFKILRSKFQSEITYSCLQFSFLGRNNEIISECLKCQTPDKYCMEYAIISHNIEY
IKFLMNEYKIEIDERECRYNNNLQALLLCIEQIDDINISFIYSLEIDFPPLWEYFLNHDA
DINARDNNGSPALFRQVMYNRKKAVEFLLIHGADVNIIDKDSSLTSINETAFGNRFDIAK
ILISFGADLNSKDLNGRTALITSALYNSFEISELYVKSGIDINAKDDSGNTALDWAIYNY
SEKLMIFLLDNGADANSKDSRGCTALHYCSSNGYNEQIEILLSYGADINSKNNYGESVLH
SAAEYEHPKTIELLISHGAEVTATDCNGKTALHVAAEHGCVENAEILILHGIDINAKDYN
VKTSLHKATEKDRVQMIRFLISHGTDINSKDNNGDTALHYAAAK
Download sequence
Identical sequences A2DL02
5722.A2DL02 gi|121914153|gb|EAY18955.1| gi|154413824|ref|XP_001579941.1| XP_001579941.1.43485 85241.m00280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]