SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DPV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DPV3
Domain Number 1 Region: 226-578
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-90
Family Ankyrin repeat 0.00000913
Further Details:      
 
Domain Number 2 Region: 77-204
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000288
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2DPV3
Sequence length 588
Comment (tr|A2DPV3|A2DPV3_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY17549.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_453770 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIIEAVQMAAAFNNKYFRSYLKIFKKVYEEYHPAIYTPPSPAMLYFLYMDYGVLAFGITL
QTIQKLELKGFVLDVHPENTIYRAIMNDDIQSFIAFTERAGFDENQRFYNDFYEYSSRGY
TLLELCCYHGAVNCFKLLRTKFNSIISEKCLQMSFLGGNQEIMSECMKQVKPNKECMRYA
IMSHNNDFVSFLAEECNIEIVANECYLFYNLQALFILLDRTKDIGSCLVKSAYFNIPSLC
EYFLQHGANVNAMESDKFGMTAIHVATQFFNFETANFLLANGSDINIKSKIGLNPLHIAA
GKCGKEVLEFLISHGSDIKAKTREGNLAIHMAAISNQVKNTEYFLDHGFDINERNNEGVT
PLHIAVKYHSNDVADFLIQRGANINSKDLFDGTPLHFAARCKNREMVEVLVLLGADINAR
DNHQRTPLHCAGESTDTGAAEVLIAQGSDINAIDDVGFTVLHYAAEINCVKTAIFFISHG
ANVDAMAFANETPLIVAAAKNSTRVAEILILNGANINHKGIYGDNALHICAKYGSLNVAA
ILVKHGIDIKAKNFGGITPLEVAQRSRNFGMVIYLNMLYKAYGNLPNI
Download sequence
Identical sequences A2DPV3
gi|121912731|gb|EAY17549.1| gi|123508647|ref|XP_001329684.1| XP_001329684.1.43485 5722.A2DPV3 95940.m00213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]