SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DQ01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DQ01
Domain Number 1 Region: 253-537
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.51e-101
Family Ankyrin repeat 0.0000206
Further Details:      
 
Domain Number 2 Region: 57-112,140-212
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000811
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DQ01
Sequence length 539
Comment (tr|A2DQ01|A2DQ01_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY17597.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_454250 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIATELIDSKKYPPKNIIRDILNIIPYNNRYTKSYLYLAKLIYDNYHVKEVKSRRINIDI
LFYKEYGINSDKNGYFGEINSENLNIHADDTIYRAIMYNDLEKFIFFTEREEFDKDQKLM
SDLYPYEIKRYLSSYKGYSLLELCCYHGAVDCFKLLRTKFNSEITETCLKFSFLRGNPEI
MSECLKYKKPDYQCMEYAIISHNIDFVTFLINEYKIEIDLGYSGIYNNLESFLVYFDQTN
DINKCFVYSTLFDFPSLSEYFFSHGAEINTKFKYGETALHAAIYRNNKEMSDFLISHGAN
INEKDRDEQTAIHYSATNNNKEIAELLLSHGANINEKDKNGTTALHYAAKNNRKEIVELL
ISHGANVNEKEKNGRTALHYAAKNNRKEIVELLILQGADINEKDNLGKTALHYSATNNNK
EIAELLLSHGANINEKDGGEQTALHYAVYFNSKEISVLLISRGANINEKDNLGKTALHFA
AEYNCKETAELLISGGANINEKDNDEQTALHIAVSKDYKEISELLLSHGANINEKDIPG
Download sequence
Identical sequences A2DQ01
gi|121912779|gb|EAY17597.1| gi|123508829|ref|XP_001329732.1| 95940.m00208 5722.A2DQ01 XP_001329732.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]