SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DT35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DT35
Domain Number 1 Region: 227-438
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-54
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 126-254
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000183
Family Pseudo ankyrin repeat 0.048
Further Details:      
 
Weak hits

Sequence:  A2DT35
Domain Number - Region: 30-90
Classification Level Classification E-value
Superfamily IpaD-like 0.0207
Family IpaD-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2DT35
Sequence length 582
Comment (tr|A2DT35|A2DT35_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY16442.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_004730 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQDNLPNEYSELRSMFKYHIDVYVALYQLKTENEEDLNSIYKMIKTNLIDSKKCSPQN
IIERISKIIPHNNRYIKSYLTLMKLITDGYNLTEVRDIPITWAFLFYKEYGIKLDKYANF
EEMNLQNIDIHSENTIYRAIMNNDLETFIFITEKEGFDKNQQLQSSLYPESEEGYSLLEL
CCYHGAVDCFKLLRTKFNSEITEQCLWFSFLGGNQDIMSECLKYQEPDYECMEYTIISHN
IDFVTFLMNEYDIDINISDCAEYNNLESFLVYFDQTNEVNQCFIYSALFDNPSLCEYFLS
LGANVNEKNIYGATALDNAVRNNSKKTAEFLITHGATINTPGKYSVLHVAAIKNSKETAE
ILISHGADIDGIDENYNTPLIYAANKNNSEIVELLISHGANVNKKDEYGFTSLHFTAREN
NAKMAQLLISHGAKPNKKMTAEKPLFILQQLIIVKKQLNFLFHMVQISMKKIIMDEPLFI
LQPCIIVKRQLNFLFHLVQISMKKIILDKLLFILQPLKIIKKQLNFLFHMVQISMKKIKR
RKPLFILQPCIIVKRQLNFLFHLVQISMKKIILDKPLFILQP
Download sequence
Identical sequences A2DT35
XP_001328665.1.43485 5722.A2DT35 80413.m00210 gi|121911611|gb|EAY16442.1| gi|123504081|ref|XP_001328665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]