SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DTA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2DTA1
Domain Number - Region: 53-78,171-228
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00418
Family Pseudo ankyrin repeat 0.039
Further Details:      
 
Domain Number - Region: 51-144
Classification Level Classification E-value
Superfamily STI-like 0.0916
Family Clostridium neurotoxins, C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DTA1
Sequence length 451
Comment (tr|A2DTA1|A2DTA1_TRIVA) Exosome complex exonuclease, putative {ECO:0000313|EMBL:EAY16373.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_359820 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIMNLEADQLKKIKKLINKHAYSLAICSGNLEMIRCVQNFILERPFNQKEMKIAINKGRI
NIARWIAENSDLSHPNISLNSTEYSLYFYSQYVDLGFLLDGSRIDNFSNLSVIINTSQKL
ADQKPLFYENCNTNCISLLACHNLLDVQKAFKIYSIENISTIKVLVENLPDICKLTLSHL
KAALTTKNLTAVEYILTKGVKLEDLTPEERIESALSSNNPRIINWIFDRTPLEGINVARL
YHYGPFPSWIKKLWKDKLKELNLEYTFEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
EEEEDISWIRKLWKDKLKELNLKYAFEEEEKEEKEEEEEKEEEEEEKKEIKQVKYTSLET
QNAEPFLSKDKELSKVENEDERAKSSCCSLL
Download sequence
Identical sequences A2DTA1
92757.m00261 gi|121911541|gb|EAY16373.1| gi|123503773|ref|XP_001328596.1| 5722.A2DTA1 XP_001328596.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]