SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DTB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DTB1
Domain Number 1 Region: 261-545
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.3e-101
Family Ankyrin repeat 0.00000835
Further Details:      
 
Domain Number 2 Region: 109-226
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000314
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2DTB1
Sequence length 574
Comment (tr|A2DTB1|A2DTB1_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY16383.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_359920 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MTEKNIHPNKYCELRSIYKYYIDSYFALYQLKTEKEEELSSIYKIIKTELIESKKYTPKK
IAEDILNIIPYNNRYTKSYLYLTKLISDDYQVELHDEYGYGDEFEYIFTENTIYKAIMYN
NLIVFILFTEIDEFDKNQKLESDLYPHSKEGYSLLELCCYHGAVDCFKLLRTKFNSEITE
KCLQFSFLGGNPEIMSECLKYQTPNEKCMKYAIISHNIDFVTFLMNEYNIEIDLYYCEKF
KNLESFFVYFDQTSDVNKCLINSVIFNIQSLCEYFLSHGANINEKDNGGLTALHIAVDSN
QLEIVEFLLSHGANIDEKDNDGLTALHIAVKSNQLKIVEFLLSHGANINEKDYLGKTALH
IAVKSNQLKIVEFLLSHGANIDEKNNDGLTALHFAVLYNDKETVEFLLSHGANIDEKDYL
GKTALHIAEMFNNEEIVKFLLSHGANIDEKDNDGLTALHIAVKSNQLKIVEFLLSHGANI
NEKDYLGKTALHIAVKSNQLKIVEFLLSHGANINEKDYLGKTALHIATKINNEETVEVLI
SNGAKNRTYFFSYIKEKIHSFLSTLYVLIFKMHK
Download sequence
Identical sequences A2DTB1
gi|121911551|gb|EAY16383.1| gi|123503806|ref|XP_001328606.1| XP_001328606.1.43485 5722.A2DTB1 92757.m00260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]