SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DTD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DTD6
Domain Number 1 Region: 125-369
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.72e-76
Family Ankyrin repeat 0.0000308
Further Details:      
 
Domain Number 2 Region: 9-84
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000157
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2DTD6
Sequence length 385
Comment (tr|A2DTD6|A2DTD6_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY16408.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_360170 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MRSDFYITSYSLLELCCYYGAIKYFKFLRTKFKTDITRTCLNYSFLGGNAEIINECLKAV
SPGGYAHACALMTHNIDFVTYLMNEHDIIPKPYYCGLYCNTQSLFIYLAETKDIYECIKY
SPIFGIPSLCEYLLSHWPDVEMKSGEHQGSALHKAAEYHYTEILDIFVRHGADIDIKDFD
NQTPLHISVKESDLESIKFLVSHGADVNAEDNHGNSPLHAAANGRNKMIAMLFISHGADV
NAKDDEGITPLHCAAKSNRKEIAEILISHGADINAKDYKGNTPLHYAAESNGKEIAEILI
SHGANVNEKDDAGGRTPLHKAMLKGGIDLLEFLISHGADVNAKDHNGETPLHDAAYISNT
DVVKFLVSHPIFRPKLTIFSFLFEI
Download sequence
Identical sequences A2DTD6
5722.A2DTD6 XP_001328631.1.43485 gi|121911576|gb|EAY16408.1| gi|123503901|ref|XP_001328631.1| 92757.m00276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]