SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DTI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DTI5
Domain Number 1 Region: 283-610
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-116
Family Ankyrin repeat 0.00000727
Further Details:      
 
Domain Number 2 Region: 120-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000128
Family Pseudo ankyrin repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2DTI5
Sequence length 612
Comment (tr|A2DTI5|A2DTI5_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY16294.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_423470 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQDTHSKKYSELRSMYQYSIDSYNALYQLKTENEEEIHKIFKMIKTELIDSKKLLPHT
IISDILCIIPYNYRYTKAYLSLAKLIYDNYQINKEIDAPLTVRYIFYKEYGIKLDKSDNF
ETINSKNLDIHTEDTIYRAIMYNDLERFITFTEIEGFDKDQKLKCDLYPYSYYGYSLLEL
CCYHGAVDCFKLLRTKFKSEITQTCLEFSFLGGNPEIMSECLKYQKPDKYCMFYAIISHN
IDFVTFLMNEYNLKVDLDVCVLYRNLESFLVYFDQTNDVNKCFLYSARFNIPSLCEYFLS
IGANVNGKDKYGQTALHYAAKYNRKEAAELLISHGANVNEKDKDGKTALHFTAVFNNSKE
IAELLISHGANVNEKDNNGRTALHYAAVFNNRKEIAELLISHGANINEKDKDEKTAFHIA
AEKNSKETAEFLISHGANINEKDKYGETALHFTAYNNSKEIAELLISHGANVNEKDKDGK
TALHSAAEKNSKETAELLISHGANVNEKNKHGKTALHYAAVFKNSKEIAELLISHGANVN
EKDNNGRTALHYAAVFNNRKEIAELLISHGANVNEKDKDEKTALHYATKFHRKEIAELLI
SHGANINEKNEE
Download sequence
Identical sequences A2DTI5
XP_001328517.1.43485 gi|121911461|gb|EAY16294.1| gi|123503449|ref|XP_001328517.1| 5722.A2DTI5 94962.m00216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]