SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DWR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DWR0
Domain Number 1 Region: 280-595
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.05e-94
Family Ankyrin repeat 0.0000213
Further Details:      
 
Domain Number 2 Region: 131-247
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000418
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DWR0
Sequence length 600
Comment (tr|A2DWR0|A2DWR0_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY15092.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_392090 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MCNQGIDPPDYNVLRSNYKSYIDSYNALYQLKTDKEEDLRSIYNMIKTELIDSKKQLPEN
VIQDILDLIPYNNRYSNSYLVLVKLISEDYQVTIDVNPIEDLTKCYLHEEDGKIILGAIV
NSSKNQDIHSENTIYRAIMNDDKERFISFTESDSFDKNQKLKNNLYPYHSTSYSFLELCC
YHGAVDCFKLSRSKFKSEITQQCLEFSFLGGNPDIMSECLKYQTPDEECMKYAIISHNID
FVTFLMNEYDIEIDLEYCGEYNNLEAFFIYFDQTNDVDKCFIYSPIFNIPSLFELFISLG
ADINAKDINGITALHQASISNNKKAVEFLLSHGANVNEKCYDFKTALHFATILNYIEIVE
LFLSHGANINEKDFDEKTPFAYAMLHNYKEIIKLFLLHGANPNEIINEECTALFYSLFND
DKEITELLLSHGANANERMNDENTALHFASIRGNKEIVEPFLLHGANINEKNCDELTALH
LATNSKHKEIVELLLSHGASIDEKNITGQTPLFFAVHNKSIEIVELLLSHGANINEKDMF
GKTPIFQAESFRELDLIEFLISHGANINETNNNGETLLDCAISINNAELIEFLHLHNSKS
Download sequence
Identical sequences A2DWR0
5722.A2DWR0 93865.m00177 gi|121910243|gb|EAY15092.1| gi|123498079|ref|XP_001327315.1| XP_001327315.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]