SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E071 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E071
Domain Number 1 Region: 289-605
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.49e-106
Family Ankyrin repeat 0.0000232
Further Details:      
 
Domain Number 2 Region: 131-254
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000863
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2E071
Sequence length 627
Comment (tr|A2E071|A2E071_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY13990.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_491290 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDHDIHPKKYFELRSAHKDYINSYTALYRLKTEKEEELNSIYEMIKTELIDSKKYLPKN
IIRDILDIIPFNNRYAKSYLYLAKRISDDYQVKETSKIPLVSNCLFYKEYGITLDKSEHL
EKYYLDDLDFQTENTIYKAIVDNDKEKFIQFIERDDFDKDEILQSLLYPNSRERYSLLEL
CCYHGAVDCFKLLRTKFKSDITQKCLQFSFLGGNPEIMSECFNDRSLFFQKPDEICMQYA
IISHNIDFVTFLMNEHKLEIDLEYCGMHKNLELFLIYFDQTNDFKKCFVYSAMFGITSLC
EYFLSHGAKINDKDDFGKTALHYAAKYNNKEAAELLISCRAKINEKDKDKKTALHYAAEC
NSKETAEFLISHGAKINEKDKDKLTPLHYAARYNREEIAELLISHGAKINEKSREKKIAL
HYAANYNNKEIAELFLSHGAKINEKDEYGKMALHYAAECSNKEIAELLISHGAKINDKDK
YGSTALHYAAFLGKKEIIKLLISYGANINEKDSSGETALFLGVKFGNKEITELLISYGAK
INEKNIFGKTALYHAVDLQKKEIIKLLILNGANINEKYENGETVLHIAEQKHDKEIVELL
ISNGREGQSCYLSLFHKNIMGKKLSYS
Download sequence
Identical sequences A2E071
5722.A2E071 XP_001326213.1.43485 gi|121909124|gb|EAY13990.1| gi|123493097|ref|XP_001326213.1| 97225.m00188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]