SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E0J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E0J6
Domain Number 1 Region: 277-469
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.91e-63
Family Ankyrin repeat 0.0000782
Further Details:      
 
Domain Number 2 Region: 50-253
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000157
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2E0J6
Sequence length 472
Comment (tr|A2E0J6|A2E0J6_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY13876.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_044380 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MLSEEYQELMELNKDYVNITDALYKLKTFDEAEIERIYQDIKTKLIESKKVSPSYIIDMI
SVAMSYNLRYTKSYMAIFEKLYEDYQPKQAKITYPIFAYLIFKEYDIVLDKRHEPLFDSY
LSKNISIEIHEKNSIYRAIMDDDLMSFITFTEQEGFDKNAQLNSPLYPYTIYQGYYYLDL
CCYYGAVNCFKLLRSKFGSPITTSCLEFSFLGRNAEILSECMKESEEFDRCKKYAIISHN
IDFVSFLMNEHNINIYLGYCDCHNLHAFLVYLDQTKDFNTCFVHSPNFCNLNLCEYLISH
GADVNAIDDLDKSALHTAAESNCKEIVEFLLSHGANVDAIEKTNGETPLHKVAEINNPEI
AELLISHGANVNATNYGDETPLHLASNWNCEDTAKVLIDHGADVNAKAELGRTPLHCAAK
YNSYETAELLISHGADINAKDLYGITVLQYASRKDSEDVEELLYSLGADEGE
Download sequence
Identical sequences A2E0J6
XP_001326099.1.43485 gi|121909008|gb|EAY13876.1| gi|123492587|ref|XP_001326099.1| 5722.A2E0J6 81840.m00179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]