SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E1E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E1E2
Domain Number 1 Region: 87-321
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.35e-67
Family Ankyrin repeat 0.0000449
Further Details:      
 
Domain Number 2 Region: 37-110
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000118
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2E1E2
Sequence length 326
Comment (tr|A2E1E2|A2E1E2_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY13509.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_343380 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MDDDKISLIFFTEGEEFDKNQKLKSNLYPYSRGGFSLLELCCYHGSVDCFKLLRTKFQSE
ITPDCLRFSFLSGNKDIMNECLKVQKPDYYCMEYAIISHNIDFVTFLMNEHNIEIDLEMC
SQYKNLQSFLVYLDQTNDINTCFVYSRHFHLSSLFEYFISNGADINAKDEVGCTPLHLVA
SENNIEMAEILISNGADINAKDGVEATPLHYAASNNSKETAEILISSGADINAKDESGCT
PLHNAIRFIGKDTAEILISNGADINAKDIYGCTPLHLIASNNSKETAEILISNGADINAE
NKDGSTPLQIEASNNSKETAENLMLL
Download sequence
Identical sequences A2E1E2
5722.A2E1E2 XP_001325732.1.43485 gi|121908636|gb|EAY13509.1| gi|123490988|ref|XP_001325732.1| 92153.m00215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]