SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E1V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E1V5
Domain Number 1 Region: 131-359
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-82
Family Ankyrin repeat 0.0000735
Further Details:      
 
Domain Number 2 Region: 27-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000497
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2E1V5
Sequence length 361
Comment (tr|A2E1V5|A2E1V5_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY13304.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_164130 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MHNDKVKFIYLTERDDFDIDHRFIGLSYLACPGKCSLLELCCYYGAVDCFKLLRTKFNLE
ITYMCQEIISECLKYQTPDEACMNFAIISHNIDFVTFLMNEYNITINLYDCGAYNNLESF
LVFFDQTNDFNICFIYSAWFDIPSFCEYFLSHGANINEKDKFGRTALHYASQNNNIKIVE
YLISHGANINEKDKVGRTALQNAARSNRKETAKLLISHGANINEKDIVGKIALHYATLQN
YKEFTELLISHGANINEKDRIGKTALHYAAEFNRKENAELLISHGANINEKDRIGKTALH
YAAEFNRKETAELLISHGANINEKDRIGKTALHYAAEFNRKETAELLISHGANINEKDVN
K
Download sequence
Identical sequences A2E1V5
5722.A2E1V5 85862.m00267 gi|121908428|gb|EAY13304.1| gi|123490071|ref|XP_001325527.1| XP_001325527.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]