SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E3T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E3T3
Domain Number 1 Region: 286-577
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-104
Family Ankyrin repeat 0.0000131
Further Details:      
 
Domain Number 2 Region: 124-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000497
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2E3T3
Sequence length 587
Comment (tr|A2E3T3|A2E3T3_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY12721.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_117430 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSENDIDPNKYSELRSIYKHYIDSYIALYQLKTEKEEEIKDIYQQIKTELIDSKTYPPKK
IIKDILCIVPYNNRYTKSYLFLVKHISDDYHVTDIRNVEHISNFLFYKEYGIKLDKSDDF
EKINSENLDIHKENTIYRAIMYNDLERFITFTEMDGFDKDQKLKSSLYPNFHHIVYSLLE
LCCYHGAVDCFKLLRTKFQSPITQTCLQLSFLGGNPEIMSECLKYQKPNRECMDYAIISH
NIDFVTFLMNEYNKFINLDCCAVHCNLDAFLVYFDQTNDVDKCFVYSVMFNIPSLCEYFL
STGANINEKDIDGKTALHIAARYNCIETVELLISHGANINEKNKDGETSLHIAANNNSKE
TAELLISNGANINEKNDDAGTALHIAAFENHKETVELLISHGANINEKNDYGETALHVAA
YNNSKETAEILISHGININEKDDDGGTALHNAVYYNYKETAELLISHGININAKNDNGRT
ALHVAVYDNRKEIAELLISHGANINEKNNDGKTALHTAASNNSKETAEILISHGANINEK
DEYGQTALDTATFFNHKETAELLKSHDIKINKKDNGGTKRSSNCSIL
Download sequence
Identical sequences A2E3T3
XP_001324944.1.43485 84222.m00161 gi|121907835|gb|EAY12721.1| gi|123487422|ref|XP_001324944.1| 5722.A2E3T3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]