SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E5I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E5I8
Domain Number 1 Region: 294-679
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.5e-125
Family Ankyrin repeat 0.00000822
Further Details:      
 
Domain Number 2 Region: 135-262
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000102
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2E5I8
Sequence length 688
Comment (tr|A2E5I8|A2E5I8_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY12029.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_038750 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MEKVNYEDLMDMCQDFIYVYDTLYKLKTFNKKEINKIYLDIKGLLLETKQASPNQILTII
STAMIHNIKYLKQYKAIFNKIYKEYHPIFTHNELKNIPHILWADLSDENGVLLSEKYIYD
FARNKYKYSTTNFMEENTIYRAIMYDDKFSFIAFIETDGFNKDQMLENDLYPSKPLSLIE
LCCYHGAVNCFKYLITRFKSTITQKCLWYSFLGGNSDIIQECLKIEEPDEECMRYAIISH
NIDFISFLMSEYEFEIDLYNCVIYHNLQAFLVYLDQSKYINKFFIYSVCFCIPSLCEYFL
SHGADVNSKTEIGRTALHFAAEFNCIKIAESLISHGADVNAKDNDGHTVLCQAAYNNSKK
IFELLISHGADINAKDNKERSNLHYAAENSSIEIVEFLISHGADVNAKDNIGFSSLLYAA
YSSNLETIQLLVSHGADVNSVDISGESVLGAAIFENHKDIVEFLISHGADVNAKRGLERL
SALHKAVEESSIEIVELLISHGADVNDKDNNGESILHFAAYRKCKEIAELLISHGADVND
KDNNGDSILHIAVDRNSKEIVELLISHGADVNDKDNDGDSILHIAAYRKCKEIAELLISH
GADVNAKNNNGDSILHAAAKNNYIEIVELLISHGADVNAEDNDGLSVLYAAAIDNHKEIV
ELLISKIMLEYQKKIQNDNQHWFNYQLF
Download sequence
Identical sequences A2E5I8
gi|121907132|gb|EAY12029.1| gi|123484386|ref|XP_001324252.1| 5722.A2E5I8 81617.m00157 XP_001324252.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]