SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2E975 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2E975
Domain Number 1 Region: 285-661
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-141
Family Ankyrin repeat 0.00000476
Further Details:      
 
Domain Number 2 Region: 644-1000
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-139
Family Ankyrin repeat 0.00000449
Further Details:      
 
Domain Number 3 Region: 126-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000102
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2E975
Sequence length 1000
Comment (tr|A2E975|A2E975_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY10760.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_121640 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSEKDIHPNKYSKLRSIYRYYIDSFNTLYRLKMENEEEINSFYKMIKTEMIDSKKCLPQD
ITRDILNIIPYNNRYAKAYLYLAKLISDDYHVKELVDVVTISDFLFYKEYGIKLEKSHNF
EKIKSENLEIHTENTIYRAIMYNDLKRFISFTERDDFDKNQILKSDLYPKCEKGFSLLEL
CCYHGAVDCFKLLRTKFNSEITQKCLRFSFLGENPEIMSECLKHLQPDEKCMKYAIISHN
IDFVSFLMNEHNIEIDPCFCGFHKNLDAFLVYFDQTNDYNICFVYSVIFNIVSLFKYFLS
LGANINEKTESGKTALHYAACLNSKETAEILISDGANVDEKDNDGETSLHYAAYINSKET
AKLLISHGTNVDEKNNDGKTALHYAAINNSKETAELLISHGANVDEKNNDGETSLHAAAI
NNSKETTELLISHGANVDEKNNDGQTSLHAAAINNSKETTELLISHGANVDEKDNDGKTA
LHYAAIYNSKETAELLISHGANVDEKDNDGKTALHAAAINNSLETAELLISHGANVDEKN
NDGETSLHAAAINNSKETAELLISHGANVDEKNNDGKTSLHAAAINNSKETTELLISHGA
NVDEKDNDGETSLHYAAYINSKETAKLLISHGTNVDEKNNDGKTALHYAAINNSKETAEL
LISHGANVDEKNNDGKTSLHAAAINNSKETAELLISHGANVDEKDNDGQTSLHAAAYINS
KETTELLISHGANVDEKDNDGKTALHYAAIYNSKETAELLISHGANVDEKDNDGKTALHA
AAINNSLETAELLISHGANVNEKDNDGQTSLHYAAINNSKETAELLISHGANIDVKDNLG
KTALHYAARKNRKKTAELLISHGANVDEKDNDGKTALHAAAINNSLETAELLISHGANVD
EKNNDGETSLHAAAINNSKETAELLISHGANIDVKDNLGKTALHYAARKNRKKTAELLIS
HGTNVDEKDNDGKTSLHYASINNSKETAELLISHGANIDE
Download sequence
Identical sequences A2E975
84285.m00222 gi|121905839|gb|EAY10760.1| gi|123479652|ref|XP_001322983.1| 5722.A2E975 XP_001322983.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]