SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ECP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2ECP1
Domain Number 1 Region: 293-600
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.25e-96
Family Ankyrin repeat 0.0000236
Further Details:      
 
Domain Number 2 Region: 132-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000119
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2ECP1
Sequence length 602
Comment (tr|A2ECP1|A2ECP1_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY09537.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_276100 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSEQDENPDQYIELRSIYKYYIDSYNALYQLKTEKDEDLSSIYNQLKTELIETRKYSPVK
IVRDVLSIIPYNNRYAKSYLSLAKLISDDYHVKEVNNVEPISNFLFYKEYGIKIDKAYDF
KEFKSENLEIHKEDTIYKVIMNNDIKRFILFTESDEFDRFQVLKSKLYPDSKKGYSLLEL
CCYHGAVDCFKLLRTEFNSEITQKCLRLSFLGGNPEIMSECLKHHKPKEKCMKYAIISHN
IDFVTFLMNEYKMRIDSYYCGMYNNLESFFVDFDQKNNFRKCFVYSTMFDLPYLCEYFLS
LGADINDKDEDGRTSLHIAAYYDFKEIAELLISHGANIDEKDNDEKLPIHYAAYFNSKET
AELLISHSAIINGKDKYGETTIHKVAYFNSKETAEFLILHGANIDEKNEEGNTVLHIAAF
HNNKETAEVLILHGADIDAIDEDGRTALHIAAFHNCKETAEFLISHGADIYAIDDKFGDA
PLHLAAHKNSKEIVENLILHGANINEKNKLGNTALQKAAMYNSLEADEILILRGANINGK
NKNGRTALHYAAIHNCKETAEFLISHGAAINVKDKSGKTLLQAARCEHSNETAELLIANG
EK
Download sequence
Identical sequences A2ECP1
gi|121904593|gb|EAY09537.1| gi|123477183|ref|XP_001321760.1| 89419.m00195 5722.A2ECP1 XP_001321760.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]