SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EDT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EDT5
Domain Number 1 Region: 294-533
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.77e-68
Family Ankyrin repeat 0.0000826
Further Details:      
 
Domain Number 2 Region: 105-253
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000235
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2EDT5
Sequence length 541
Comment (tr|A2EDT5|A2EDT5_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY09151.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_363660 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MKSGVYDEVMSFAKDYIDTINALYQLKANDEEEIDAFYKFLKTNLLDTKLYKPGELIREI
QDVAVFNNRYFKSFWTIAKRIFEDYQPKVIERITPLFDYFFYKEYGIVFNETNKKYFNQF
EAKNYSIDVHEENSIYKAIMKNDIKSFIIFTEMDGFDKDQKYSSNFYPRQSTSYTLIELC
CYHGAVDCFKLLRSKFNSKITHKCLHFSFLSGNPEILNECLKYEKPCRDCISYAIISHNI
DFVTYLMNEHNIPIYINCCNDFNNLQTYLIGLEQTNDFNSCFLHRPYFHLPAFYKYILDH
CPDITKKGNFYGRRAFENVINENRYDIAEILISHGVDVNIMNDVEESALHLAAINGRKEL
VELFISNGVDVNIKERYNHTPLHYAAKNGNKEIVQLLIDNGAVVNAKNNQNITPIHETLN
NKNTEALEILIANGADVNAITADGYSPLHMAIYICNSNAAEVLLSHGADINKTNYLNETA
LHIAAKENKIDMVKLLISHGADVNIRNYEKKSALDYAVNKNYKEIADILISHGDVNSNSN
V
Download sequence
Identical sequences A2EDT5
XP_001321374.1.43485 5722.A2EDT5 92876.m00137 gi|121904199|gb|EAY09151.1| gi|123476403|ref|XP_001321374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]