SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EDT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EDT8
Domain Number 1 Region: 219-569
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-125
Family Ankyrin repeat 0.00000405
Further Details:      
 
Domain Number 2 Region: 68-184
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000484
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2EDT8
Sequence length 570
Comment (tr|A2EDT8|A2EDT8_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY09154.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_363690 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIPYNNRYTKSYLSLAKLISDDYHVKEVNDVKIISNFLFFKDYGIKLDKSTDFGKFYIKN
FNILTEDTIYRAIMYNNLEAFISFTEREGFNKDQTLKNELYPYHFIVEEYSLLELCCYYG
AVDCFKFLRTKFDSKITQTCLEFSFLGGNPEIMSECLKYQKPNKDCMEYAIISHNIDFVT
FLMNEYNIEIDLDYCVLYNNLESFLVHFDQTNDIDECFLYSATFNFPSLLEYFISHGANI
NTKNKNGSTALHIAAWNNRKEMAEILISHGANINEKDGDGETALHNVIARNYKEMAEFLI
SHGANINEKNKNGDTTLHIVARENRKKMTEFLISHGANINEKDGDGETALHIAAWNNRKE
MTEFLISHGANINEKNKNGETVLDLAAWNNSKEIVEVLISHGVNINEKNKNGKTALDLAA
ARNYKEMTEFLILHGANINIKNKNGSTALHVAARNNSKETAEILISHGANVNEKDGDGET
ALHIVARKNSEEIVEILISHGANINEKDGDGETALHITAARNYKEMTEFLISHGANINEK
NKNGKTALDLAAAWNYKETANVLISHGAKE
Download sequence
Identical sequences A2EDT8
gi|121904202|gb|EAY09154.1| gi|123476409|ref|XP_001321377.1| 5722.A2EDT8 92876.m00139 XP_001321377.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]