SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ELL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2ELL1
Domain Number - Region: 15-69
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0255
Family Fibrinogen coiled-coil and central regions 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2ELL1
Sequence length 75
Comment (tr|A2ELL1|A2ELL1_TRIVA) Heat shock factor binding protein, putative {ECO:0000313|EMBL:EAY06458.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_149440 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSATNTNTTGATQEEQLPTQPEDLANFMDQIFSQMESKFTDMAQQVLKRIDEMSSKINEL
ESSIDTLMQQAEQDK
Download sequence
Identical sequences A2ELL1
gi|121901446|gb|EAY06458.1| gi|123470957|ref|XP_001318681.1| 85335.m00161 5722.A2ELL1 XP_001318681.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]