SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2END7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2END7
Domain Number 1 Region: 272-526
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-63
Family Ankyrin repeat 0.0000829
Further Details:      
 
Domain Number 2 Region: 129-144,173-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000562
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2END7
Sequence length 527
Comment (tr|A2END7|A2END7_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY05807.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_202640 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
METIDYMETMKLFKDYNDTFRSIFRLNTSNEDEINKIYINIKSNLFEKTYITPSLILGII
QNAANYNFRFFRSYWTLFKKIYDEYHPTKIEDCSWVFCYIFYKEYGLLLDKEHDFDIEDP
EMIESLKAHEENTIYKAIIDDDLNSFIVFTEKEGFDENQLMYSYIYPDFELTLLDLCCYY
GSVNCFKLMRSKFNSEITENCLHYSFLSGKPEIMNECLKFQTPDDECMDYVITSYNIDFV
TFIMENYNIEIDPFHCENVFNLQAYFLHFFHTNDLPTCFTHSPFFYNKSLCEFLLSHGAD
VNQEGVDGRFVLDYACLKNIKELAEFFINNGSLLYPSDFDGLTSLHFAAMGDSKETAEML
LLHGAEIDPYDHENKTPLCYAIHDYNFETAKFLILQGADVNAEEIIHIAAVAGSVEIIEL
LISHGADVNAKDYLGKIPLHYAAQGNSTELLETLISNGSDINAKDDDGRTPLHDAIPSMH
PHIIDFLISHGADINAVDNFNRTALQIAENTDNEEIIQLINRYINQK
Download sequence
Identical sequences A2END7
5722.A2END7 gi|121900779|gb|EAY05807.1| gi|123469639|ref|XP_001318030.1| XP_001318030.1.43485 87022.m00198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]