SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ENE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2ENE5
Domain Number 1 Region: 276-659
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-131
Family Ankyrin repeat 0.00000716
Further Details:      
 
Domain Number 2 Region: 116-241
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000523
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2ENE5
Sequence length 676
Comment (tr|A2ENE5|A2ENE5_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY05815.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_202730 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MAIYAVSTNTTSMHTLHCISLKRKKEEDLNSIYQMIKTEMIESKKHLPQNIIRDILDMIP
YNNRYTKSYLTLAKLISDEYQVKDISNVNPISNFLFYKEYGIKLNKSTNFAKFNPGNVDI
QAENTIHKAIMYNEKEKFISFTEREGFDKDQILISKLYPHLYFSEGYTLLELCCYYGAVD
CFKFLRTKFDSKITEICLVFSFLGGNPEIMSECLKYQKPNEYCMEYAIISHNIDFVAFLM
NEYNEKINLQVCGIHKNLEAFLVYFDQTHASNECFIYSAMFNVPSLAEYFLSHGGNINEK
DEFEHTALHHAVRNNNTEMLEFLISHGANISERDTDLGTALHSASEKNSKEIAELLISHG
ANINEKDNKGKTPLHCAACNNCPKETAEFLISHGANINEKDGQGKIALHYAALENNNETT
ELLISHGANINEKDNNGETALHYTAEYNCYETAELLISHDANINEKDKYERTALHHAILK
NNKETYNLLISHGANVNEKNKYGKTALHYATENNFKETAEHLISHGANINEKDKYGQTSL
HYAATKNSKETAELLISHGANINVKNGEGKTALHYAALKNNKETAELFISHGANINEKDN
NGKTALHYAASENSKETAELLISHGANINEKDGEGKTALNYAVDKNRKEMEEFLISHGAI
KYSSFNRFISSFLGKN
Download sequence
Identical sequences A2ENE5
XP_001318038.1.43485 gi|121900787|gb|EAY05815.1| gi|123469655|ref|XP_001318038.1| 5722.A2ENE5 87022.m00213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]