SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ENT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2ENT3
Domain Number 1 Region: 111-170,271-470
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-39
Family Ankyrin repeat 0.00068
Further Details:      
 
Weak hits

Sequence:  A2ENT3
Domain Number - Region: 46-80,147-204
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000745
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2ENT3
Sequence length 476
Comment (tr|A2ENT3|A2ENT3_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY05709.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_005530 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MFDDNIVTYDKLYHIKSNESIDEVFALIEKVLISKYKTSSINIVLTILEAIRYNYRSINI
YIDLLKRIITKYPIPSLPKEQVETAKYNGLILSTNPEEICLIDRSLYEQEENEIMEIIAY
DQIDKFKEYTCTTTKNRVFSFDIPYFKRVTLLEGCAYFGSVNIFMFLFPNSYKAPETFEC
AIMGGNTDIINECLKHDMFYYHIVQTSIECHNNQFLEYVLEMELVNIREYWFMFQPIFTS
TNLKALFLMYNKYKEGIAPCFAEFPQLNDIIKNKIIDFTSNIELFLEKAIHHNNFEMVNF
FIDYYKENNSLSDSILEDNLFLALFFNRSEIAKFLVSLGAKLNDDIVLNDEFIDAVRKLN
EEIAKLLISIGADVNLEIDDYHSYLHKAVLDNDSKRVALLVKLGANINSKDEDRNTPLHL
AIMERNYNIVDLLISHGADLEAKGENGLTPLQLAEAYIASDIVQLLISKGTNVDAK
Download sequence
Identical sequences A2ENT3
XP_001317932.1.43485 80444.m00143 gi|121900678|gb|EAY05709.1| gi|123469440|ref|XP_001317932.1| 5722.A2ENT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]