SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EP14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EP14
Domain Number 1 Region: 170-433
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.87e-54
Family Ankyrin repeat 0.00026
Further Details:      
 
Weak hits

Sequence:  A2EP14
Domain Number - Region: 57-140
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0445
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2EP14
Sequence length 475
Comment (tr|A2EP14|A2EP14_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY05618.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_263880 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIIMNCFTKLHYRQGYIDLLEKIYKEYNFSDGIDKSFFEFIPPDEEIIMNDDVEGLLNYM
NNGTYDLTTLLEKCCLRGAINCFKLLKDDFNVEITKKCLDNSFKGGNQYIINECLEEQNP
DKETMEAVIESHNIDNFKKLYDLNTGFQIKSLVVEKNLHAFIYYLNRTNDLDTCFLFSPY
FNIPSFCEYLYANGANMSSMSTDGDSTLDIAVLTNHTETASFLISKGIEMDEKAFYYAVS
SNSTVMVELLVSHGADVNFREKNTGFSMLHIACLNDNIKAVEILISHGININDNENDKGL
TPLMIVSILNYKEIAEFLLSHGASINMQDKNGEIALHHAIMHDCKEFTEFIANKIEFLAY
HDRYQVVLGEFGNFSDLIEILVSNGAYVNAKNKDLHSPLHLAAFTFDCKIAEILISHGAI
VNSLNIYGVTPLDFVIFRIKSKDGNDPDVLEELNKVRRCLISHGGKTSLQMKKKM
Download sequence
Identical sequences A2EP14
gi|121900585|gb|EAY05618.1| gi|123469256|ref|XP_001317841.1| XP_001317841.1.43485 89034.m00129 5722.A2EP14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]