SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EPI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EPI5
Domain Number 1 Region: 269-523
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.75e-77
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 119-242
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000327
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2EPI5
Sequence length 540
Comment (tr|A2EPI5|A2EPI5_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY05414.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_197150 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSEQYFDFQRIFRYDIDTYNAVHQLNTENKEELNKIYQMIKTNLIDSRRYRPRKIIENIL
NIIPYNNRYAEQYLELAKHIYDEYRVEGVMYCNIFNYLFYKVYGINLNKSADFEENNSDN
LNVHTENTIYRTIMYNDLKIFISFTEREGFDKDERLISKLYPHSKKGYSLLELCCYHGAV
DCFKLLRTKFDSKITQKCLRFSFLGGNPEIMSECLKYQKPNQKCMKFAIISHNIDFVTFL
MNEYNLEISLYDCGKYNNLESFFVYYAQTNDINECFYLSALYEMLPLCEYFIVHGANIHT
KNCCGDSAFHQAVNHNNKEMAELLLSYGANINAKNIFGNTPLHMAALDDRKEMVEFLISH
GANIDLQGRAGETALQYAAANNRKEVLKVLISHGANIYEKDYYDNTALQLASYNDSKEMI
EYLISNGANIGDKNKHGRTALHNAANENRKETTEILISHGANVNDKDIYGNTPLHFAACK
NCKETAELLLSHGVNIRIKDNDGNTAFRVAVENNCKETAELLFAYGTGLRLILPPEPRTA
Download sequence
Identical sequences A2EPI5
XP_001317637.1.43485 5722.A2EPI5 gi|121900376|gb|EAY05414.1| gi|123468843|ref|XP_001317637.1| 86800.m00113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]