SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EPK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EPK8
Domain Number 1 Region: 129-398
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-81
Family Ankyrin repeat 0.0000335
Further Details:      
 
Domain Number 2 Region: 12-158
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000101
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2EPK8
Sequence length 408
Comment (tr|A2EPK8|A2EPK8_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY05437.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_197380 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MQNLYPSESNSLLELCCYHGSVRCFKLLLSKFHCDITEKCPSYSFLSGNADIMNECLKEQ
DPDDSCMEYAIIAHNIDFISFLMNEFELKIDLTYCVYFNNFPAPLVYLDQTKDINSFFIA
SILLDIPMIYKFFLSVGIDVNVQAKIGTTALQAAISIHNIAAIKFLISHGADVNLKNKQG
TAPIHLAAQINSNGIVELLIRNGAEINAKDENGNTALHIAAFCFGHHVAKLLISHGAEIN
AKNYDEYTPLHFAAEKNNKDIAELLVLHGAFINARENHGSTPLHIAALNNCKETAERLIS
HGADVNAKNDDKSTPVHSAAEFYKSKDIVELLVSHGALINANDINRSTPLHIAALNNSKE
TAELLILHGANIYAEDNSGLTPLSNAIWKNCKPIIDLIFQMFLILMRK
Download sequence
Identical sequences A2EPK8
5722.A2EPK8 XP_001317660.1.43485 gi|121900399|gb|EAY05437.1| gi|123468889|ref|XP_001317660.1| 86800.m00124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]