SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ERA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2ERA8
Domain Number 1 Region: 254-507
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-86
Family Ankyrin repeat 0.0000714
Further Details:      
 
Domain Number 2 Region: 99-230
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000392
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2ERA8
Sequence length 530
Comment (tr|A2ERA8|A2ERA8_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY04784.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_305330 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSEQDILPNKYSELRGIYKSYIDTCNALYQLKTENEEELNSIYKMIKTELIDSKKYHPRN
IIYDILKLIEYNNRYKKSYLYLCKLISDDFNIKFIWNLNVSIHENDTIYRAIMENDKERF
IALTEGYSYPLLRSSLYPYNSIGYSLLELCCYHGAVDCFKFLRTKYKSEIYNRCLELSFL
GGNPEIMNECLKYRKPDKWCMTYAIISHNIDFVAFLRNEYKIEIDLYDCGLFNNLEAFLV
YFDQTNDIDNCFIYSTMFNIPALCEYFLSQGANINYKNQEEITALHLAAIKNRKEVVEFL
LSHGANINEINEDGQTALHYAASNNSKETAELLISHGANINEMDEDRKTALHFAISSGSK
VTAELLISHGADINKKDRDGKTAFHMAADQNSKAIAEFLLSLGANINEKDKRGLTALHYA
ASRNYKEMAEFLISHGANIKTIDEDGRTAFIHAAMQNSIETVEFLFSHGAHINRKDHYGS
TALHYAALGYADETVKFLLLHGAHIDEKIVEEKLLFILQHFKIEKKQSKF
Download sequence
Identical sequences A2ERA8
90487.m00113 XP_001317007.1.43485 5722.A2ERA8 gi|121899730|gb|EAY04784.1| gi|123463812|ref|XP_001317007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]