SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ET07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2ET07
Domain Number 1 Region: 463-518
Classification Level Classification E-value
Superfamily RING/U-box 0.00000147
Family RING finger domain, C3HC4 0.034
Further Details:      
 
Weak hits

Sequence:  A2ET07
Domain Number - Region: 304-310,354-424
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0034
Family Pseudo ankyrin repeat 0.028
Further Details:      
 
Domain Number - Region: 8-88
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 0.0691
Family Pyruvate phosphate dikinase, C-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2ET07
Sequence length 547
Comment (tr|A2ET07|A2ET07_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY04196.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_298140 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MTEGKLKGIRRINSSGSGQVRLEEMMPKQLIIIDYDEVKRNAENDFIEGRYDDALEKYSQ
IISQYDPELVIVKFFNYGLEKHLPKYLMKVFWSGQATVHITQLLISILSKYKLNDSVHNF
VTIVNNAQKVNSGQISEAEDPKWSKYKVLYPTLNIDTIIDMLNQCGYQNEASRIRISNRI
SDYDIQALIFEQKNYLEAATKIHNSSQDPNGKHLLLKFGPTLLSLDSASGRLISQAASIY
YRKEAQNDGTEFVKLLWGYPAYLTSFLKDAIAEKPTPLLVTLYLELILPSKTKTMFNSDN
ISNETAFIAIIKNKDIQFNENQILSICAENKYVLGVVWILTRKQLFHDAITYALNNNLDD
KKLIDYCLEVEASIHPKDWSNLFAIYTGEQKWAKLQGFDNFVHFIQKAVINTLKVRNIDF
VFSTLLKNPLVTFKFIDNNIKKALANLYNENKRVVHDQKAIQDQINSIKTSEEVQYPLIC
SICQRKITYPCAIFKCGHIVHQSCSGTDKNCCPICKHIDPAVNVKERFNNDQESDHASRI
IISTVFQ
Download sequence
Identical sequences A2ET07
gi|121899125|gb|EAY04196.1| gi|123457383|ref|XP_001316419.1| 90246.m00095 XP_001316419.1.43485 5722.A2ET07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]