SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2ETS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2ETS1
Domain Number 1 Region: 277-528
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.03e-68
Family Ankyrin repeat 0.0000369
Further Details:      
 
Domain Number 2 Region: 122-139,171-305
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000327
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2ETS1
Sequence length 528
Comment (tr|A2ETS1|A2ETS1_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY03952.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_314820 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MTYQEVIDLYKDHISAMDALYKVNTYNEDEIDQIYKKIQMNLIKTKLLSLSWILKIISNI
SIFRNRYMSLYWLLFKKIFEEYRPDQVQDIEFPFEYFVYKDYGIILNEDNVKSYENLKIS
IDVHQENDIFKAIMDDDIKKFITFTDQKGFDQYQRFNSILYPKNFERSYSLLELCCYHGA
VKCFKLLIAEFKSEITHKCLQFSFLSGVPDIINECLKYVQPDVKCMKYAIISHNIDFVMF
LYNEYHINIDLLYCGKFNNLQAFAVYLDQTKNLKHCFIYSSIFNIPSLCQFFLLHGVSIN
EKDKNIIPYNTSLYRAAQFNCIETVKFLIKCGMKINGINGMGRTALHEAVRKNSKKAIKL
LVMHGAEINLADRLGITPLHLAAHRASKEIVEYLISHGAKVNSKNDRNETPLHFAAVRNG
KEIVEFLIINGAKVNVKNKESNTPLHIAAINGFKETLEVLILHGADINSKNSNRSTPLHL
AALSNNKEIIELLILHKADINAKNSGKETPLSLTKNKQIISILRSHGA
Download sequence
Identical sequences A2ETS1
XP_001316175.1.43485 5722.A2ETS1 gi|121898874|gb|EAY03952.1| gi|123456886|ref|XP_001316175.1| 90925.m00106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]