SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EWP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EWP2
Domain Number 1 Region: 151-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.64e-80
Family Ankyrin repeat 0.0000353
Further Details:      
 
Weak hits

Sequence:  A2EWP2
Domain Number - Region: 25-110
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000667
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2EWP2
Sequence length 478
Comment (tr|A2EWP2|A2EWP2_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY02930.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_040800 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MLDDVKSFIGYIEANGLDLYQMPVNESCPSINIASCSLLDLCCFYGAVGCYKFLRTKYNF
MIGETSLHCAFLGGKPDIMNECLKVIKPDQACMEYAIMSHNIDFVSFLMNEYRLKIDLNW
CCKYKNLQAFLVYLDYTQDITNCFLYSPCFNIPALCEYFMSHGFDIRTKNENGSTVMHFA
SYFNCKDILGFLISHGGKVNEKSNYKKTLLHLAAKNNCMEVIKLLISHGARVNAKDLNRY
TPLHYAIENNNKDAVEYLVNHGASLDGKTVSKTALHIAVLNGSIDMVEFLLSLGADINIK
DKKGRTVLWIAAQKNSQRLIDFLISRGSNLDVIVNGESLLVYAINHFQDELSNKLIDHHA
DLSIRDHYGRTALDYAVSFENKVIIEKLLSNGAPVNLQDKSGMTPLHHAIDGRNYELIEI
LLSHGADITIKNKDKLNPVSYAAKYGPYKMNEFIISHSHHYDKKENKNDPSELPMDEL
Download sequence
Identical sequences A2EWP2
5722.A2EWP2 gi|121897821|gb|EAY02930.1| gi|123454807|ref|XP_001315153.1| 81679.m00099 XP_001315153.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]