SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EWZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EWZ1
Domain Number 1 Region: 175-434
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-66
Family Ankyrin repeat 0.0000634
Further Details:      
 
Domain Number 2 Region: 10-105
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000114
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2EWZ1
Sequence length 449
Comment (tr|A2EWZ1|A2EWZ1_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY02833.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_293010 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MHDQINEFKEYIINHPVDEIRLPIFVFNYYPAIDFAAFYGSVNIFYFLLSNCGSKITDDT
LHYSVIGGNTDIINECLKVFPVDKLCYKYAIETHNHKFLEYLFGQQDFNIELIHDYYWVP
DYRYGFPRLVEFQNLKFMFLLYEKDKNSTIPWCSAFPQAIEILNDKELDLSIVDYRKTSI
LHYAVHFDDNKEVIELLLSRGVDINSKDKFNKTALHYAVTNKCKGIVELLCKHGIDINAK
DRKNKTALYYAAKLNLIEIAELLLSHNADINIKEIRGRTAIDIAVKRNCKASLEILLSHN
SDINNNAKDDKNNNKPALHTTAIYGHRDIVETLLSHGADINAKDNENKTALHYAVQHKYT
EIVKLLCSHGIDINATDSNNRTALHYAAANFGMEIIKILLSFGADVNIKDINNKTAGQIA
LDIPFPSIARLLLPKTEFSDYSEEDEEDN
Download sequence
Identical sequences A2EWZ1
90053.m00095 gi|121897721|gb|EAY02833.1| gi|123454608|ref|XP_001315056.1| XP_001315056.1.43485 5722.A2EWZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]