SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2F3Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2F3Z4
Domain Number 1 Region: 285-599
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.56e-84
Family Ankyrin repeat 0.0000365
Further Details:      
 
Domain Number 2 Region: 108-252
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000102
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2F3Z4
Sequence length 606
Comment (tr|A2F3Z4|A2F3Z4_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY00348.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_406970 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDKDNHPNKIGELRSICKYHIDLYNSLYQLKTEKDEDLNSIYKMIKTEMIDSKKCLPKN
IIRDILKVIPYNNRYTKSYLKLAKLISDDYRVKEVSRVKLIPTISNYLYYKEYGIKLDKS
DNFEEIKSENLDIHTENTIYRAIMYDDRDRFITFIERDDFDEGRKLKSSLYPNYYKGNSL
LELCCYHGAIDCFKLLRTKFDSEITDKCLELSFLGGNPEIMSECLKYQKLNDKCMEYAIA
SHNIDFVTFLMNEYNKRINLYDSVEYNNLESLLVYFDQTNDINKCFIFSAMFDIPSFCEY
LLSHGANINEKFNCKETALHIAAKFNCKETAKLLISYGANINEKNLLGYTSLFTSALNNC
KETAELLISQGANINEIDKNGNTALHAAALNRFKEIAELLISHGVKINEKNNDGRTPLHI
TTKYISKEMAEILIPHDTKFINDDHIIISNRKYKEIVEGSILEMVAKNVNTTFLNAALHP
SLIEDCKEITKLLISHGANINEKDIFGNTALHNAVHENYKEITKLLISHGANINERDIFG
RTALHYAASYNSKEIVEILIKHGANINEKDISENTALYYAGIHFHIEIEEILISHGGNPA
LGCAVY
Download sequence
Identical sequences A2F3Z4
gi|121895155|gb|EAY00348.1| gi|123449110|ref|XP_001313277.1| 5722.A2F3Z4 94275.m00114 XP_001313277.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]