SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2F6W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2F6W1
Domain Number 1 Region: 83-210,262-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.97e-32
Family Ankyrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  A2F6W1
Domain Number - Region: 393-466
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.051
Family Pseudo ankyrin repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2F6W1
Sequence length 468
Comment (tr|A2F6W1|A2F6W1_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX99378.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_015610 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MLLDGGANVNESNHDTKSNLFECFNPKFMKLVLEYHPILFFDAPKFYILNRRLDVAKELI
RYYPKEDHYLIYNAAISLCSYDMVKYLIDHNFDFDSRSIDGMTPIFDAIRFNQIDIPKLL
INSGANLENTDINGETAILYATSFLSRGKFGNNHLNMPNINNMNDLIKFLIDCDANINTE
NKSHNNLLQNSIVNGNILLYNKLKYLGIKTQLINNESLDSLRKKIKVTGETLFTYIVKND
NIIFLELYNSIIVEEKKIPDINVQNVSGETPIMCVIKYNKNPAYLTLLIRGGADADQEYQ
GKTPLQICIENEYTDKIRAFLQNECCDLNKKFDNRMSYFHLAIKMNKKLSMRALASYVFP
DFVDKDGNSYLHYAALSNDREITYICLHVQEKYIVYNNENMSPLMLASSINSFRYIDQFI
DFCDKHWIPIKDKYRSLFLAVMNRSFDSYYSILKIILCSVDPNSENTK
Download sequence
Identical sequences A2F6W1
80729.m00105 5722.A2F6W1 gi|121894150|gb|EAX99378.1| gi|123447130|ref|XP_001312308.1| XP_001312308.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]