SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2F895 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2F895
Domain Number 1 Region: 107-314
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.76e-60
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 3-78
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000575
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2F895
Sequence length 321
Comment (tr|A2F895|A2F895_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX98855.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_145920 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MNGNSLLEICCYYGSAQCFKLLRTKFNSEITQACLDFSFLGGNPEIMSECLKVQKPKENC
MKNAIISHNIDFVTFLVNEYDLEIDLEMCGRFKNFQAFLVYYDLTNDSNKCFVYSPLFNN
QSICEYFVSNGTNINSTDQKGKTALHIASYYNIKDIAKYLLSQGADINTKDKDGSSAIRL
AVIDGGFETAELLLSYGANINEKNNQGDTIFQEALLYVGEDRAKFLISHGADINAKNEIG
QTILHQVVLMHLEKHIEFIISNGFDINAKDNRGMTALHYASMSKSKEIANILISYGAENN
IKDNNGETPQSIAEYFLKDEE
Download sequence
Identical sequences A2F895
5722.A2F895 XP_001311785.1.43485 gi|121893608|gb|EAX98855.1| gi|123446062|ref|XP_001311785.1| 85234.m00104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]