SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FF10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FF10
Domain Number 1 Region: 122-284,373-472
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.7e-29
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 10-74
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-16
Family Ankyrin repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  A2FF10
Domain Number - Region: 324-381
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0706
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2FF10
Sequence length 491
Comment (tr|A2FF10|A2FF10_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX96514.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_148660 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MKFALQYHAVNERNSDEWTPLHNAASNGQIDACKLLLSQPGIDLNPTNNHNETPLDLAIK
KGYQTVIDYLRQNGCVASSPPRQNRRKYYNSPPKALSPIDELKNLKPNPSNFNSIYKIVD
NAILNQDANTIRFAIENEYMKVQDTDKPFYNNVALEAAFRGGRDFIIFLEVCGYNPKNDF
FLHKFAQIGDVEGVEYALKFHDINEKGENWWTPLHYAVDRCQMESCKLLLSKQGIEKNQL
NQKDETPLDLANRVFKDETEAEKNARQELVDFLKSQGCQESIIKPIIIDDEQKEPLNIPQ
DLSSIQKLQHVPKEPRNFDMIFGILLDSYEKNDHETIEYAVKNDYLKLTKAGDRLTNIVI
EAATKANLKFIQYLEKYGYSPKDDFILHEFSYIGDVEGMKFALQYHNVNERDGGERTALH
IAASSGQIDACKLLLSQPEIDKNPTNNRNEMPLDLAIKNDNQTVIDYLISNGCEETQKTL
VPGQVRIHVIN
Download sequence
Identical sequences A2FF10
XP_001309444.1.43485 gi|121891171|gb|EAX96514.1| gi|123437293|ref|XP_001309444.1| 5722.A2FF10 85304.m00067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]