SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FG62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FG62
Domain Number 1 Region: 248-590
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.86e-117
Family Ankyrin repeat 0.0000248
Further Details:      
 
Domain Number 2 Region: 61-102,133-222
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000392
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2FG62
Sequence length 590
Comment (tr|A2FG62|A2FG62_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX96101.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_014930 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MIKTELIDSKKHPPENIIKDILNIIEYNNRYTKSYLKLAKLISDDYHVTDVSNITNLSNY
LFYEEYGINLDKTKNLETNNLQNLKIHSEDTIFKAIMDNDLEKFIAFTERQGFDKDQNLK
SNLYPSSYEGYSLLELCCYHGAVDCFKFLRTEFKSTITDTCLKFSFLGRSKENLSECLKY
LKPNEFCMRYAIISHNIDFVTFLMNEYSLYIDLEYCAEHNNIESFLVYFDRNHYVDKCFV
FSPMFNIPSFCEYFLSRCYHVNIRVNGLTALHRTTWNNCKEITELLISHGIFVDVIDNNG
KTALHYAALNNSKEKADVLISHGANINEKDSYGQTALHIAALNNSKGITELLISHGADIN
EKDNSGQTALHNASRKNCKEIVDLLISHGANINEKENNGKTALHLAAEYNSKETAELLIS
HVANIYEKNNSGQSALHYAARKNCKETAELLISHGANVNEKDNSGQTALHNATVGNSKET
AKFLISHGANINEKDKEGKPLLHHAAWNNCKETAELLISHGANINEKDNSGQTALLHAAC
YYPKEMTELLILHGANINEKDNSGQTALQIATIKNFEEIAEVLISHGANI
Download sequence
Identical sequences A2FG62
80710.m00056 XP_001309031.1.43485 gi|121890739|gb|EAX96101.1| gi|123435730|ref|XP_001309031.1| 5722.A2FG62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]