SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FHI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FHI3
Domain Number 1 Region: 287-597
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-83
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 123-148,179-269
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000654
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2FHI3
Sequence length 660
Comment (tr|A2FHI3|A2FHI3_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX95618.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_047160 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MENNSPSRYHELLELNKSYVDTFNALYKLNTSNESEIKKICKDIKNNLITTKYFLPMQIL
RIIAIAAKYNNSYISSYRVIFKRIFETFRHKQVEYGENLFNYFICNECVIGVDSKNTECL
DYFIINDQNKKRLEDDTIYNIIMNDNVELLKIYTERKDFKIKQEFYNDFYPFRVDGYSLL
ELCCYHGSVNCFNFLRTNFHTEITSKCLQLSFLRGNQHIVTECLNVVRPTQECMEYAIAS
HNIDFVIYLVNEYHLHLDLDLCVYFHNLETFLFYYEITHDTNKCFVKSTYLGIPSLCEYF
LSEGASIKSADEFGRTALSISSWSNRKSVVEFLISHGCDVNETNQIGRTALHKAVLNNSK
EVINYLISNKANVNSKDNNGETPLYTAVVNNFNTVAVLLIQKKADVNIRDKNNESILCKA
VLNNNKELVELLVSKGANVNESRLNKTCLQIATENNYSDIAEFLITHNANANAINMDRMC
ALLYAIKNNNKEIVELLISNGADVDVCGSEGKTPLHYAAEKDFKEIAEILILHKARIDAF
DDDHRTPLHYAAMNNSFETARVLINNGASTVARDKDYINPLEYTRINGNRDLEQLIREYN
RINGIDDNTDDDDDDDDDDYGYYDDDDDYGYYDEIYSYNGFPFGLIYNDDDYDDDDDDYY
Download sequence
Identical sequences A2FHI3
5722.A2FHI3 XP_001308548.1.43485 gi|121890234|gb|EAX95618.1| gi|123433099|ref|XP_001308548.1| 81877.m00056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]