SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FIT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FIT9
Domain Number 1 Region: 288-533
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-83
Family Ankyrin repeat 0.0000431
Further Details:      
 
Domain Number 2 Region: 124-256
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000017
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2FIT9
Sequence length 535
Comment (tr|A2FIT9|A2FIT9_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX95192.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_032590 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDPDIHPNIYSELRNICKHHIDSYIALYQLKMEKEEDLNSIYRLIKTELIDSNKYPPQI
IMRDILNIIPYNNRYAKSYLSLAKLISDDYHVTEVRNVEQPISNFLFYKEYGIKLDKSYD
FEKFNLENLDIHIEDTIYRAIMYNDLERFITFTEREYFDKDQILKCDLYPYSYYGYSLLE
LCCYHGAVDCFKLLRTKFNSEITGNCLEFSFLRGNPDIMSECLKYQKPDEYCMKYAIISH
NIDFVTFLMNEYNIRIKLDYCVQFNNLESFLVYLDQTNDINKCFANLAMFNIPSLCEYFL
SNGANVNEKGEYGQTALHYAACYNNKETAELLISHGANINEKDKYGTTALHFAAKYNSKE
TAELLISQGENINEKNNYGTIALHFAAEKNSKEIAELLILHGININEKNDLRETTLHYAA
EKNSKETAELLILHGININEKDHRKRTALHYAAEHKFKETAELLISHGINIDEKDNDGKT
ALHIAARYNLKEIAELLISHGININEKDIFGLTALQIAARYNYKEIAELLISQLM
Download sequence
Identical sequences A2FIT9
XP_001308122.1.43485 gi|121889785|gb|EAX95192.1| gi|123431330|ref|XP_001308122.1| 5722.A2FIT9 81399.m00043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]