SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FK11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FK11
Domain Number 1 Region: 272-570
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.92e-88
Family Ankyrin repeat 0.0000427
Further Details:      
 
Domain Number 2 Region: 124-303
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000051
Family Pseudo ankyrin repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2FK11
Sequence length 580
Comment (tr|A2FK11|A2FK11_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX94758.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_346210 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQDIHQNRYIELRSIYKNYIDSYNALYQLKTENEGELNSIYKIIKTELIYSKKFLPQD
IINDIFNIIPYNNRYTNSYFSLAKLISDEYRVKEVKEVPNFLYYKEHGIKLDKSEDFEKI
KSENLDIHAENTIYRAIMYNDKERFIIFTEREEFDKDQKLDSKLYPGSGFSLLELCCYHG
AVDCFKLLRTKFNSKITETCLQLSFLGGNPEIMSECLKYQKPGKECMRYAIISHNIDFVT
FLMNEYNIEIDLEYCQEYKNLESFLVYYDQTNDINTSFVESIVFNIPSLCEYFLSNGANI
DAKDGCRNTALHIAVYFNYKEITELLLSHGANINEQDMWGHIPLIHAIHYNNKELAELLI
LHVEKISEKDKGRTFALHYAVLHNNKEMAEFLILHGANINVEINFGRFALLIAADNNYKE
MAEFLISHGANINKKNILGTTALECATFYNKIETAELLISHGAGINEKNKNGKTALQYAV
ENNRKEITEFLILYGANINEKDKNGKTALHYAAENNRKDITEFLILHGANINEKDKNGKT
ALHYAMHNNYMKIAGLLLSHGANLSEKDKNRKKHSSLCSI
Download sequence
Identical sequences A2FK11
5722.A2FK11 gi|121889331|gb|EAX94758.1| gi|123429352|ref|XP_001307688.1| 92258.m00074 XP_001307688.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]