SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FMC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FMC0
Domain Number 1 Region: 300-573
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-62
Family Ankyrin repeat 0.0000598
Further Details:      
 
Weak hits

Sequence:  A2FMC0
Domain Number - Region: 224-287
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0262
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2FMC0
Sequence length 594
Comment (tr|A2FMC0|A2FMC0_TRIVA) Tankyrase, putative {ECO:0000313|EMBL:EAX93937.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_307160 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MEKDFHSFSELEVPSELKLFYDIQMKLGSLSPQSIDETSKYIGQNLNSTLDYLLLVRDVS
AISRYRPQAQELYADLLFKIGTFTSNPNNLTKIIAGSAAPQLLVFLFIKGMLSLTDIKHR
AVSDSNARFFLQPFVKLDRDWLSNPSFADFMKFYDDLIADDYKEWIEVAKHGVKKGQFGY
ILKHDLVDQFSARIQSPEDFEKPFKWSPFEVPIEQDLVAFGEAAAFYGSEKIFKCIASQV
SDFDKYIKFAVLGGNKTIINMCLSNNKSRAENCLNFAMDSFRFDLFEELQKYNCTPPLTH
MACETHNYPVFIYTIRGKFDPNNRINKNAYPLISIACNTNDIHMVEFLISKGANVNVPTN
SEFPIHIAASNGNLEIIKALLDSGANPNEENNGKFTPLHLTAISGATNVAEYLLEKGASI
DAENDWNQTPLQLAVESSKPEVAKLLINKGANVKVKVNGEGKDSSNKKFTAKNRNLLHFA
CFINDIQLCQYLLKMGVDVNAEDEYRITPLLIATQNGKSDICKLLISNGAKVNVKDSQML
TPLHLAAQSGNFELVKLLVENGADVKAKGGDGFPIRKAKSDEIKKYLMAKMQGK
Download sequence
Identical sequences A2FMC0
5722.A2FMC0 gi|121888465|gb|EAX93937.1| gi|123425677|ref|XP_001306867.1| 90528.m00066 XP_001306867.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]