SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FME9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FME9
Domain Number 1 Region: 283-511
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-73
Family Ankyrin repeat 0.0000526
Further Details:      
 
Domain Number 2 Region: 133-146,177-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000549
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2FME9
Sequence length 525
Comment (tr|A2FME9|A2FME9_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX93924.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_342410 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQDFLPSKYSELRSIYEYYIDSYNELYQLKTIKEEELRQIYNLIKIELIDSKIYPSKK
IIKDIFYIIPYNNRYTKSYLSLTKLICDDYHVEEVKDIPTISNYMFYKEYGIILDKSEDF
EKIKFMNIDIHSENTIYKAIMHNDLERFITFTEIEGFNKDKKLRSDLYPYFIKGYSLLEL
CCYHGSVDCFKLLRSKFNSEITQKCLQFSFLGGNPEIMSECLKHQTPDEFCMKYAIISHN
IDFVTFLLNEYNIQIDLECCGEYNNIESFLVSFDQTYDLNKFFVYSTIFNISSLCEYFLL
NGANINAKNIDGKTALHIATSKINNNKEIVELLLSHGANINEKDNYGATALHKAGYNNNK
EIVELLLSNGANIDEKNSFGRTTLHNAACYNCQEIAKLLLSHGANINARDNDGRTPLHYA
TDSNRKEFVKLLLSQGANINEKDLNERTALHIAAANCSKEIVELLLSYDAKIDEKDKNGR
TALHIATKNCSKDIIELLLSYDANINEKDKSMENKCGNTGLEMAK
Download sequence
Identical sequences A2FME9
gi|121888451|gb|EAX93924.1| gi|123425617|ref|XP_001306854.1| XP_001306854.1.43485 92132.m00056 5722.A2FME9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]