SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FPS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FPS7
Domain Number 1 Region: 284-603
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.9e-106
Family Ankyrin repeat 0.00000716
Further Details:      
 
Domain Number 2 Region: 135-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000196
Family Pseudo ankyrin repeat 0.05
Further Details:      
 
Weak hits

Sequence:  A2FPS7
Domain Number - Region: 16-72
Classification Level Classification E-value
Superfamily Ribosomal protein S7 0.00562
Family Ribosomal protein S7 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2FPS7
Sequence length 628
Comment (tr|A2FPS7|A2FPS7_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX93107.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_261170 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQNIQPDKYSELRSKYKYYINSYHALYQLKTENKEELHSIYKMINTELIDSKKYLATS
VMKDILNIIRYNNRYTKSYLFLAKLIFDNYQVKKVENVNIISYLLFFKEYRIRLYESYSI
EEIILENLDIHKENSIYRAIMNDDKEIFISFTERDEFNKDQKLKSDLYPYCTDGYSLLEL
CCYHGAVDCFKLLRTKFHSQITNTCLQFSFLRGNPEIMSECLKYQTPDKYCMAYAIISHN
IDFVTFLMNEYNLEINLFDCGEHKNLESFLVYFDQTNDISKCFVNSAMFNIPSLCEYFLS
NGANINEKREYILTALHIAAQRNNKEVVEILLSHGANINVKDGMEETALHKAANRNSKET
TKVLLSHGANINEKNNNGKTALHIAAYCNYKELAEVLLSHGANINEKDNNGETALHITLN
RNSKETTKVLLSHGVNIDEKDNNGSTALHIAAYCNYKELAEVLLSHGVNINEKDNNGETA
LHKAVYRNSKETIEVLLSHGANINVKDGMEETALHKAANRNSKETTKVLLSHGANIDEKD
NNGSTALHIAANRNSKETAKVLLSHGANIDEKDNNGETALHIALNRNSKGTTKVLLSHGA
ITNMFFHKMLIFLFLIVSILFFIRNKDN
Download sequence
Identical sequences A2FPS7
XP_001306037.1.43485 gi|121887589|gb|EAX93107.1| gi|123421686|ref|XP_001306037.1| 88950.m00061 5722.A2FPS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]