SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FV24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2FV24
Domain Number - Region: 80-133
Classification Level Classification E-value
Superfamily BH3703-like 0.0458
Family BH3703-like 0.018
Further Details:      
 
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily SPy1572-like 0.0484
Family SPy1572-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2FV24
Sequence length 144
Comment (tr|A2FV24|A2FV24_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX91254.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_162760 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDYIYYDSFPERFRELFKTQVKLRNMHFNKDRPIDDERNPEYITIPYDAKFIAYIPYGR
RGTKTISTKNKNYFWSDEENCLIYINVYLNKATYCTKEGWTGFELYIYDDDGNRRCVYPY
DNMYHCFHQALNEYIVSKGLIPAE
Download sequence
Identical sequences A2FV24
XP_001294020.1.43485 XP_001304184.1.43485 85851.m00040 95636.m00005 gi|121871538|gb|EAX81090.1| gi|121885618|gb|EAX91254.1| gi|123333226|ref|XP_001294020.1| gi|123412935|ref|XP_001304184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]