SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FW02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FW02
Domain Number 1 Region: 298-580
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.68e-107
Family Ankyrin repeat 0.00000664
Further Details:      
 
Domain Number 2 Region: 118-254
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000131
Family Pseudo ankyrin repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2FW02
Sequence length 582
Comment (tr|A2FW02|A2FW02_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX90911.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_469860 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSKGETNQTHYDKLMEIFAGYNDVYNTLYRLKTNDEEKLNAIYKKIKQNLIDSYQIQPDV
IINDISKLSIYNNRYMKSYLAIAKQIVDEYHLNQVNKINKVFNYLFYKEYNIVLNEKAKK
RFNEFEHSHYSSDIHDQNTIYRSIMDDDKISLIFFTEREEFDKNQKLKSKLYPYSYEGIS
LLELCCYHGSADCFKFLITKFQSEITPDCLRFSFLSGNQDIMNECLKVQKPDDVCMKYAI
ISHNIDFVTFLMNEHNIEIDLKLCSIYNNLQSFLVYLDQTNDINACFVYSPNFHLSSLLE
YFISNGADINAKGKYGCTPLHYAARYNSKETAEIFISNGADINAKGKYGCTPLHWAARDN
SKETAEILISNGADINAKDKDEWTPLHWAASANSKETAEILISNGADINAKDKDEWTPLH
WAARDNSKETAEILISNGADINAKDKDEWTPLHYAARDNSKETAEILISNGADINAKDKD
EWTLLHYAASANSKETAEILISNGADINAKGKYGCTPLHYAASANSKETAEILISNGADI
NAKDVNECTPLHYAASANSKETAEILISNGADINAKDKDGRI
Download sequence
Identical sequences A2FW02
96543.m00052 gi|121885250|gb|EAX90911.1| gi|123411183|ref|XP_001303841.1| 5722.A2FW02 XP_001303841.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]