SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FWE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FWE7
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000458
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2FWE7
Sequence length 152
Comment (tr|A2FWE7|A2FWE7_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX90774.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_380700 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MGHFEASTLENIIVSHNFQLFLDIQKDYELDLNGLIPFIARNYNLKMFLYSLCHAKSKTN
AFIYYGYIQVPEIYEYFCQQQKPTNRELLEQAEQSDNVSLIKILLDHGMEFDPSDLSFDG
HILKNLILPDSFEVYKYVFNHFDKKDLPVHFI
Download sequence
Identical sequences A2FWE7
93457.m00050 gi|121885103|gb|EAX90774.1| gi|123410435|ref|XP_001303704.1| 5722.A2FWE7 XP_001303704.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]